PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA09G12460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 289aa    MW: 32057.8 Da    PI: 4.944
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA09G12460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.43.8e-191764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed+llv++v q+G g+W+++a+  g++R++k+c++rw +yl
  ONIVA09G12460.1 17 KGPWTAQEDKLLVEYVMQHGEGRWNSVAKITGLKRSGKSCRLRWVNYL 64
                     79********************************************97 PP

2Myb_DNA-binding50.93.5e-1670114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  ONIVA09G12460.1  70 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.31264IPR017930Myb domain
SuperFamilySSF466892.27E-3015111IPR009057Homeodomain-like
SMARTSM007171.7E-161666IPR001005SANT/Myb domain
PfamPF002494.6E-181764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-241871IPR009057Homeodomain-like
CDDcd001671.29E-121964No hitNo description
PROSITE profilePS5129424.93365119IPR017930Myb domain
SMARTSM007174.5E-1569117IPR001005SANT/Myb domain
PfamPF002496.3E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2472117IPR009057Homeodomain-like
CDDcd001672.55E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEGQQFAWGR EEGGWRKGPW TAQEDKLLVE YVMQHGEGRW NSVAKITGLK RSGKSCRLRW  60
VNYLRPDLKR GKITPQEESV ILELHALWGN RWSTIARSLP GRTDNEIKNY WRTHFKKGKP  120
SKNIERARAR FLKQRREMQQ QSQLMQTGQQ QQLGQDDDAT SAVVDDNLAE VAPPAATSLT  180
HDGELQIMQE MAPDMDDLLY YHPGDMSPYS YDDLLGSGGG ECGAVAASAG AAASTSEGSS  240
EELDGGAATW GSLWNLDDVV HDMMIDCAAG AGCCWGSFPP LQDQGLAFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-26171177106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1118070.0AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624171.10.0PREDICTED: transcription factor MYB57
TrEMBLA0A0E0IKI00.0A0A0E0IKI0_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NHV20.0A0A0E0NHV2_ORYRU; Uncharacterized protein
TrEMBLA2X7A10.0A2X7A1_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA006030-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-66myb domain protein 305